Antibodies

Jump to Filters
View as table Download
Perforin (PRF1) Rabbit Polyclonal Antibody
TA326761

USD 275.00

3 Weeks

PRF1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRF1
Perforin (PRF1) Rabbit Polyclonal Antibody
TA346390

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR
Perforin (PRF1) Rabbit Polyclonal Antibody
TA308615

USD 415.00

5 Days

Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222)
PRF1 Rabbit Polyclonal Antibody
TA385038

USD 380.00

4 Weeks

Perforin Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the C-terminal region of human PRF1. AA range:451-500