Antibodies

Jump to Filters
View as table Download
SEC14 like protein 2 (SEC14L2) Rabbit Polyclonal Antibody
TA329409

USD 375.00

5 Days

Rabbit Polyclonal anti-SEC14L2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEC14L2 antibody: synthetic peptide directed towards the middle region of human SEC14L2. Synthetic peptide located within the following region: MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEY
SEC14 like protein 2 (SEC14L2) Rabbit Polyclonal Antibody
TA351640

USD 345.00

In Stock

Rabbit Polyclonal Anti-SEC14L2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEC14L2
SEC14L2 Rabbit Polyclonal Antibody
TA367241

USD 380.00

4 Weeks

SEC14L2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEC14L2
SEC14 like protein 2 (SEC14L2) Rabbit Polyclonal Antibody
TA381323

USD 220.00

3 Weeks

SEC14L2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-270 of human SEC14L2 (NP_001191133.1).
Modifications Unmodified