Antibodies

View as table Download

Rabbit polyclonal anti-SSTR4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SSTR4.

Rabbit Polyclonal Anti-SSTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SSTR4 Antibody: synthetic peptide directed towards the middle region of human SSTR4. Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV

Rabbit Polyclonal Anti-SSTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SSTR4 Antibody: synthetic peptide directed towards the middle region of human SSTR4. Synthetic peptide located within the following region: AKLINLGVWLASLLVTLPIAIFADTRPARGGQAVACNLQWPHPAWSAVFV

Anti-SSTR4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 186-200 amino acids of human somatostatin receptor 4

Anti-SSTR4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 186-200 amino acids of human somatostatin receptor 4

SSTR4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 314-388 of human SSTR4 (NP_001043.2).
Modifications Unmodified