Rabbit Polyclonal Anti-SURF4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SURF4 antibody: synthetic peptide directed towards the N terminal of human SURF4. Synthetic peptide located within the following region: GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ |
SURF4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Xenopus, Gorilla, Human, Mouse, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | SURF4 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Turkey, Chicken, Xenopus, Salmon (100%); Marmoset, Hamster, Elephant, Panda, Dog, Bat, Opossum, Platypus, Pufferfish, Zebrafish (94%); Stickleback (89%). |
SURF4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Orang-Utan |
| Immunogen | SURF4 antibody was raised against synthetic 14 amino acid peptide from N-Terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Marmoset, Bovine (100%); Monkey, Mouse, Rat, Hamster, Elephant, Horse, Opossum, Turkey, Chicken, Platypus (93%); Panda, Dog, Xenopus (86%). |
SURF4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | SURF4 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human SURF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine (100%); Opossum (93%); Turkey, Chicken, Xenopus (87%); Salmon, Stickleback (80%). |
SURF4 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human SURF4 (NP_001267719.1). |
Germany
Japan
United Kingdom
China
