Antibodies

Jump to Filters
View as table Download
TIAL1 Rabbit Polyclonal Antibody
TA330340

USD 310.00

5 Days

Rabbit Polyclonal Anti-TIAL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TIAL1 antibody: synthetic peptide directed towards the C terminal of human TIAL1. Synthetic peptide located within the following region: WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
TIAL1 Rabbit Polyclonal Antibody
TA382520

USD 220.00

3 Weeks

TIAL1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 266-375 of human TIAL1 (NP_003243.1).
Modifications Unmodified