Antibodies

Jump to Filters
View as table Download
Zinc finger protein 30 (ZNF30) Rabbit Polyclonal Antibody
TA341543

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZNF30 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF30 antibody: synthetic peptide directed towards the middle region of human ZNF30. Synthetic peptide located within the following region: YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSI