Antibodies

Jump to Filters
View as table Download
GALNTL2 (GALNT15) Rabbit Polyclonal Antibody
TA342081

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALNT15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALNT15 antibody is: synthetic peptide directed towards the N-terminal region of Human GALNT15. Synthetic peptide located within the following region: LMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE
ST6GALNAC1 Rabbit Polyclonal Antibody
TA342377

USD 375.00

5 Days

Rabbit Polyclonal Anti-ST6GALNAC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST6GALNAC1 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC1. Synthetic peptide located within the following region: LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI2A12]
CF809396

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI4F11]
CF809431

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SIAT4A (ST3GAL1) Rabbit Polyclonal Antibody
TA356524

USD 360.00

5 Days

ST3GAL1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL1
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI2A12]
TA809396

USD 379.00

In Stock

GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI2A12]
TA809396S

USD 159.00

2 Days

GALNT10 mouse monoclonal antibody,clone OTI2A12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI4F11]
TA809431

USD 379.00

In Stock

GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALNT10 Mouse Monoclonal Antibody [Clone ID: OTI4F11]
TA809431S

USD 159.00

2 Days

GALNT10 mouse monoclonal antibody,clone OTI4F11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated