ST6GALNAC1 Rabbit Polyclonal Antibody

CAT#: TA342377

Rabbit Polyclonal Anti-ST6GALNAC1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ST6GALNAC1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ST6GALNAC1 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC1. Synthetic peptide located within the following region: LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 68 kDa
Gene Name ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Background Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues. The cancer-associated sialyl-Tn (sTn) antigen is formed by ST6GALNAC1-catalyzed sialylation of GalNAc residues on mucins (Ikehara et al., 1999 [PubMed 10536037]; Sewell et al., 2006 [PubMed 16319059]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (2) contains an alternate exon compared to variant 1. The resulting isoform (2) is shorter at the N-terminus compared to isoform 1. ##Evidence-Data-START## Transcript exon combination :: BC063830.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025082, ERS025083 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms HSY11339; SIAT7A; ST6GalNAcI; STYI
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Metabolic pathways, O-Glycan biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.