Antibodies

Jump to Filters
View as table Download
ST6GALNAC1 (N-term) Rabbit Polyclonal Antibody
AP54057PU-N

USD 450.00

2 Weeks

ST6GALNAC1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 35-65 amino acids from the N-terminal region of human ST6GALNAC1
ST6GALNAC1 Rabbit Polyclonal Antibody
TA342377

USD 375.00

5 Days

Rabbit Polyclonal Anti-ST6GALNAC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ST6GALNAC1 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC1. Synthetic peptide located within the following region: LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL
St6galnac1 Rabbit Polyclonal Antibody
TA356653

USD 360.00

5 Days

St6galnac1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated