Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against MAPK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CAAGPEMVRGQVF, from the internal region of the protein sequence according to NP_002736; NP_620407. |
Goat Anti-NOTCH3 Antibody
| Applications | IHC |
| Reactivities | Expected from seq similarity: Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLGPQPEVTPKRQ, from the C Terminus of the protein sequence according to NP_000426.2. |
Goat Anti-PIWI / HIWI Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNRKDKYDAIKKY, from the internal region of the protein sequence according to NP_004755.2; NP_001177900.1. |
Rabbit polyclonal anti-EGFR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EGFR. |
Rabbit polyclonal EGFR (Tyr869) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 869 (K-E-YP-H-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Tyr1110) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1110 (P-V-YP-H-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal NOTCH2 (Cleaved-Val1697) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human NOTCH2. |
Rabbit polyclonal anti-EGFR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein. |
Anti-KRAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 30-189 amino acids of human v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog |
Anti-ETS1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 209 amino acids of human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
Mouse monoclonal Erk2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal EGFR (Ser1070) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human EGFR around the phosphorylation site of Sersine 1070. |
| Modifications | Phospho-specific |
Rabbit Polyclonal erk1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human ERK1/2. |
Rabbit Polyclonal MEK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 200-250, containing phospho serine residues at positions 218 and 222, of human MEK1 was used as the immunogen. |
Rabbit Polyclonal Anti-ETS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the middle region of human ETS2. Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC |
Mouse Monoclonal GRB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti ERK1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti ERK2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of ERK2 protein from human, rat, mouse and dog origins. |
Rabbit anti P38 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human PID/MTA2. This sequence is identical within human, rat, mouse, bovine and dog origins. |
Rabbit anti Mek1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti ERK1/2 (P44-MAPK) (pT202/pY204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, ChiChickenen |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- with the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit anti ERK1/2 (P44-MAPK) (PairedT202/Y204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- without the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins |
Rabbit anti ERK1/2 (P44-MAPK) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal sequence of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit anti EGFR(pS1070) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti EGFR(pY1092) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MAPK1 Capture mouse monoclonal antibody, Luminex validated, clone OTI7C9
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700063 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1C8
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700470 |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Pathways
- Dorso-ventral axis formation
Filter by
Category
Target Symbol
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (583)
- Protein Kinase (452)
- ES Cell Differentiation/IPS (182)
- Adult stem cells (166)
- Cancer stem cells (166)
- Transmembrane (149)
- Secreted Protein (143)
- Stem cell relevant signaling - JAK/STAT signaling pathway (143)
- Transcription Factors (35)
- Stem cell relevant signaling - DSL/Notch pathway (23)