Antibodies

Jump to Filters
View as table Download
SRGAP1 Rabbit Polyclonal Antibody
TA344767

USD 475.00

5 Days

Rabbit Polyclonal Anti-SRGAP1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Srgap1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDECRG
SRGAP1 Rabbit Polyclonal Antibody
TA351752

USD 345.00

In Stock

Rabbit Polyclonal Anti-SRGAP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SRGAP1