Antibodies

View as table Download

JAK3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-JAK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JAK3 Antibody is: synthetic peptide directed towards the N-terminal region of Human JAK3. Synthetic peptide located within the following region: APPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAE

Rabbit Polyclonal Anti-JAK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-JAK3 Antibody: synthetic peptide directed towards the middle region of human JAK3. Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF

Rabbit anti JAK3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from the adjacent to C-terminus of JAK3 protein. This sequence is identical in JAK3 from human, rat and mouse origins.

Carrier-free (BSA/glycerol-free) JAK3 mouse monoclonal antibody,clone OTI1B4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JAK3 mouse monoclonal antibody,clone OTI2B4

Applications WB
Reactivities Human
Conjugation Unconjugated

JAK3 mouse monoclonal antibody,clone OTI1B4

Applications WB
Reactivities Human
Conjugation Unconjugated

JAK3 mouse monoclonal antibody,clone OTI1B4, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

JAK3 mouse monoclonal antibody,clone OTI2B4

Applications WB
Reactivities Human
Conjugation Unconjugated

JAK3 mouse monoclonal antibody,clone OTI2B4, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP