Rabbit polyclonal antibody to Interleukin-24 (interleukin 24)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 206 of IL24 (Uniprot ID#Q13007) |
Rabbit polyclonal antibody to Interleukin-24 (interleukin 24)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 206 of IL24 (Uniprot ID#Q13007) |
Rabbit Polyclonal Interleukin-24 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
IL24 mouse monoclonal antibody, clone B-C60, Azide Free
Reactivities | Human |
IL24 mouse monoclonal antibody, clone B-C51, Azide Free
Reactivities | Human |
Rabbit Polyclonal Anti-IL24 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL24 antibody is: synthetic peptide directed towards the C-terminal region of IL24. Synthetic peptide located within the following region: STLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALT |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI4D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI3C5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI4E1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI4H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL24 mouse monoclonal antibody,clone OTI5C8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4D1, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI4D1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI4D1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI3C5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI3C5, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI3C5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI3C5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4E1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4E1, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI4E1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI4E1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI4H4, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI4H4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI4H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI5C8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL24 mouse monoclonal antibody,clone OTI5C8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
IL24 mouse monoclonal antibody,clone OTI5C8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
IL24 mouse monoclonal antibody,clone OTI5C8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |