Rabbit anti-ETV6 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ETV6 |
Rabbit anti-ETV6 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ETV6 |
Rabbit polyclonal ETV6 Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ETV6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 84-111 amino acids from the N-terminal region of human ETV6. |
Rabbit polyclonal anti-ETV6 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ETV6. |
Rabbit Polyclonal Anti-ETV6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the C terminal of human ETV6. Synthetic peptide located within the following region: VSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFR |
Rabbit Polyclonal Anti-ETV6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the N terminal of human ETV6. Synthetic peptide located within the following region: WAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHIL |