Rabbit polyclonal anti-GRK5 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRK5. |
Rabbit polyclonal anti-GRK5 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRK5. |
Rabbit polyclonal GRK5 Antibody (C-term)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GRK5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 559-590 amino acids from the C-terminal region of human GRK5. |
GRK5 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
Immunogen | GRK5 antibody was raised against synthetic 15 amino acid peptide from internal region of human GRK5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon (100%); Marmoset, Mouse, Rat, Panda, Dog, Bat, Horse (93%); Elephant, Bovine, Pig (87%). |
GRK5 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Human |
Immunogen | GRK5 antibody was raised against synthetic 12 amino acid peptide from near N-terminus of human GRK5. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Dog, Bovine (100%); Mouse, Rat, Pig (92%); Opossum, Chicken (83%). |
GRK5 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Chicken, Horse, Human, Monkey, Mouse, Pig, Rat |
Immunogen | GRK5 antibody was raised against synthetic 15 amino acid peptide from internal region of human GRK5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Bovine, Panda, Horse, Pig, Opossum, Turkey, Chicken, Platypus (100%); Orangutan, Dog, Elephant, Xenopus (93%). |
Rabbit Polyclonal Anti-GRK5 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRK5 antibody: synthetic peptide directed towards the middle region of human GRK5. Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG |
Rabbit Polyclonal Anti-GRK5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRK5 antibody is: synthetic peptide directed towards the C-terminal region of Human GRK5. Synthetic peptide located within the following region: WGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKS |
Rabbit Polyclonal anti-GRK5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRK5 |
Rabbit Polyclonal anti-GRK5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRK5 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".