GRK5 Rabbit Polyclonal Antibody

CAT#: TA335088

Rabbit Polyclonal Anti-GRK5 Antibody

Product Images

WB Suggested Anti-GRK5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human brain

• 

  Lanes: Lane 1: 1ug human GRK5 protein; Lane 2: 0.25ug human GRK5 protein; Lane 3: 0.1ug human GRK5 protein; Lane 4: 5ug rat striatum homogenate; Lane 5: 5ug rat striatum cytosol; Lane 6: 5ug rat striatum light membrane fraction; Lane 7: 5ug rat striatum synaptic

• 

  Lanes: Lanes 1-3: 40 ug tobacco hornworm larvae intestine lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Goat anti-rabbit HRP; Secondary Antibody Dilution: 1: 10000; Gene Name: GRK5; Submitted by: Dra. Helena Porta Ducoing and Biol. Glady

• 

  Sample Type: Lane 1: 20ug mouse left ventricle heart lysate Primary Antibody Dilution: 1: 1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1: 5000 Color/Signal Descriptions: GRK5 Gene Name: Kathleen Gabrielson Submitted by:

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRK5 antibody: synthetic peptide directed towards the middle region of human GRK5. Synthetic peptide located within the following region: FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: G protein-coupled receptor kinase 5
• Database Link:
  NP_005299
  Entrez Gene 59075 RatEntrez Gene 2869 Human
  UniProt ID P34947
• Background: GRK5 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: GPRK5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 86%; Rabbit: 86%; Zebrafish: 86%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Chemokine signaling pathway, Endocytosis