Antibodies

Jump to Filters
View as table Download
Clathrin light chain (CLTA) Goat Polyclonal Antibody
TA305635

USD 375.00

5 Days

Goat Anti-CTLA + CTLB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CDFNPKSSKQAKD, from the internal region of the protein sequence according to NP_001824.1; NP_009027.1; NP_001070145.1; NP_001825.1; NP_009028.1.
Clathrin light chain (CLTA) Rabbit Polyclonal Antibody
TA342619

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLTA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLTA antibody: synthetic peptide directed towards the C terminal of human CLTA. Synthetic peptide located within the following region: KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF
Clathrin light chain (CLTA) Rabbit Polyclonal Antibody
TA342807

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLTA Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clta antibody is: synthetic peptide directed towards the C-terminal region of Rat Clta. Synthetic peptide located within the following region: EQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
Clathrin light chain (CLTA) Mouse Monoclonal Antibody [Clone ID: OTI2D12]
CF809578

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLTA mouse monoclonal antibody,clone OTI2D12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Clathrin light chain (CLTA) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D12]
TA809578AM

USD 420.00

4 Weeks

CLTA mouse monoclonal antibody,clone OTI2D12, Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Clathrin light chain (CLTA) Mouse Monoclonal Antibody [Clone ID: OTI2D12]
TA809578S

USD 159.00

2 Days

CLTA mouse monoclonal antibody,clone OTI2D12

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Clathrin light chain (CLTA) Mouse Monoclonal Antibody [Clone ID: OTI2F7]
TA809615S

USD 159.00

2 Days

CLTA mouse monoclonal antibody,clone OTI2F7

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Clathrin light chain (CLTA) Mouse Monoclonal Antibody [Clone ID: OTI2A6]
TA809631S

USD 159.00

2 Days

CLTA mouse monoclonal antibody,clone OTI2A6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Clathrin light chain (CLTA) Mouse Monoclonal Antibody [Clone ID: OTI2C2]
TA809634S

USD 159.00

2 Days

CLTA mouse monoclonal antibody,clone OTI2C2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".