Antibodies

Jump to Filters
View as table Download
Vitronectin (VTN) Rabbit Polyclonal Antibody
TA346045

USD 475.00

5 Days

Rabbit Polyclonal Anti-Vtn Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Vtn antibody is: synthetic peptide directed towards the middle region of Rat Vtn. Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI
Vitronectin (VTN) Rabbit Polyclonal Antibody
TA321171

USD 345.00

4 Weeks

Anti-VTN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-154 amino acids of human vitronectin