Vitronectin (VTN) Rabbit Polyclonal Antibody

CAT#: TA346045

Rabbit Polyclonal Anti-Vtn Antibody

Product Images

Host: Rabbit; Target Name: Vtn; Sample Tissue: Rat Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Vtn antibody is: synthetic peptide directed towards the middle region of Rat Vtn. Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: vitronectin
• Database Link:
  NP_000629
  Entrez Gene 29169 Rat
  UniProt ID P04004
• Background: Vtn may act as a cofactor for plasminogen activator inhibitor 1 (PAI-1) inhibition of thrombin.
• Synonyms: V75; VN; VNT
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: ECM-receptor interaction, Focal adhesion