Antibodies

Jump to Filters
View as table Download
GNAQ Rabbit Polyclonal Antibody
TA335040

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GNAQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNAQ antibody: synthetic peptide directed towards the N terminal of human GNAQ. Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
GNAQ Goat Polyclonal Antibody
TA311219

USD 375.00

5 Days

Goat Anti-GNAQ / ALPHA-q (aa162-175) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-NDLDRVADPAYLPT, from the internal region of the protein sequence according to NP_002063.2.