Antibodies

View as table Download

Rabbit polyclonal Anti-Mapk11 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Mapk11 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mapk11. Synthetic peptide located within the following region: VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY

Carrier-free (BSA/glycerol-free) MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-MAPK11 mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated