MAPK11 Rabbit Polyclonal Antibody

CAT#: TA342153

Rabbit polyclonal Anti-Mapk11 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MAPK11"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Mapk11 antibody is: synthetic peptide directed towards the N-terminal region of Rat Mapk11. Synthetic peptide located within the following region: VPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 40 kDa
Gene Name mitogen-activated protein kinase 11
Background The function ofThis protein remains unknown.
Synonyms p38-2; P38B; p38Beta; P38BETA2; PRKM11; SAPK2; SAPK2B
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%
Reference Data
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Amyotrophic lateral sclerosis (ALS), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Progesterone-mediated oocyte maturation, RIG-I-like receptor signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway, VEGF signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.