Antibodies

Jump to Filters
View as table Download
HNF6 (ONECUT1) Rabbit Polyclonal Antibody
TA343467

USD 375.00

5 Days

Rabbit Polyclonal Anti-ONECUT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the middle region of human ONECUT1. Synthetic peptide located within the following region: ITISQQLGLELSTVSNFFMNARRRSLDKWQDEGSSNSGNSSSSSSTCTKA
HNF6 (ONECUT1) (C-term) Rabbit Polyclonal Antibody
AP52998PU-N

USD 450.00

2 Weeks

HNF6 (ONECUT1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 363-393 amino acids from the C-terminal region of Human ONECUT1
HNF6 (ONECUT1) Rabbit Polyclonal Antibody
TA343466

USD 375.00

5 Days

Rabbit Polyclonal Anti-ONECUT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ONECUT1 antibody: synthetic peptide directed towards the N terminal of human ONECUT1. Synthetic peptide located within the following region: NAQLTMEAIGELHGVSHEPVPAPADLLGGSPHARSSVAHRGSHLPPAHPR
HNF6 (ONECUT1) Mouse Monoclonal Antibody [Clone ID: OTI4F12]
CF500196

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HNF6 (ONECUT1) Mouse Monoclonal Antibody [Clone ID: OTI4F12]
TA500196

USD 379.00

In Stock

HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HNF6 (ONECUT1) Mouse Monoclonal Antibody [Clone ID: OTI4F12]
TA500196S

USD 159.00

In Stock

HNF6 mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".