SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit polyclonal Anti-SHMT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG |
SHMT1 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence LVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALT |