RFT1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 520-549 amino acids from the C-terminal region of Human RFT1 |
RFT1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 520-549 amino acids from the C-terminal region of Human RFT1 |
Rabbit Polyclonal Anti-RFT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFT1 antibody: synthetic peptide directed towards the N terminal of human RFT1. Synthetic peptide located within the following region: GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV |