Antibodies

View as table Download

Rabbit Polyclonal Anti-DCNP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DCNP1 antibody was raised against an 18 amino acid peptide near the amino terminus of human DCNP1.

Rabbit Polyclonal Anti-RAET1E Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen RAET1E antibody was raised against an 18 amino acid peptide near the center of human RAET1E.

Rabbit Polyclonal Anti-RAET1E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAET1E antibody is: synthetic peptide directed towards the C-terminal region of Human RAET1E. Synthetic peptide located within the following region: LEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDR