Antibodies

View as table Download

Rabbit Polyclonal Anti-POMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POMT1 Antibody: synthetic peptide directed towards the middle region of human POMT1. Synthetic peptide located within the following region: LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL

Rabbit Polyclonal Anti-POMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC

Rabbit Polyclonal Anti-POMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POMT2 antibody: synthetic peptide directed towards the middle region of human POMT2. Synthetic peptide located within the following region: AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPS

Rabbit Polyclonal Anti-POMT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human POMT1