Antibodies

Jump to Filters
View as table Download
OR52N5 (C-term) Rabbit Polyclonal Antibody
AP53082PU-N

USD 450.00

2 Weeks

OR52N5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 299-324 amino acids from the C-terminal region of human OR52N5
OR52N5 Rabbit Polyclonal Antibody
TA332347

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR52N5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52N5 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52N5. Synthetic peptide located within the following region: GHTIPPSLHIIVANLYLLLPPTLNPIVYGVKTKQIRKSVIKFFQGDKGAG