Germany
Japan
United Kingdom
China
OR4F17 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 60-90 amino acids from the N-terminal region of Human Olfactory receptor 4F17 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-OR51E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal Anti-ARRB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-OR10H1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR10H1. |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Goat Anti-CAMK2A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRTAQSEETRVWHR, from the internal region of the protein sequence according to NP_057065.2; NP_741960.1. |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CaMK2- beta/ gamma/ delta (Thr287) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK2- beta/ gamma/ delta around the phosphorylation site of Threonine 287 |
| Modifications | Phospho-specific |
ADRBK2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ADRBK2 |
Rabbit Polyclonal Anti-OR2B11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR2B11 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2B11. Synthetic peptide located within the following region: LLSYGFIARAVLRIQSSKGRHKAFGTCSSHLMIVSLFYLPAIYMYLQPPS |
Goat Anti-CLCA1 (aa872-884) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PETPSPDETSAPC, from the internal region of the protein sequence according to NP_001276.2. |
Mouse Monoclonal anti-CAMK2A Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-OR1A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR1A1. |
Active filters
Pathways
- Olfactory transduction
Filter by
Category
Target Symbol
- CAMK2B (29)
- GNAL (23)
- PRKG1 (15)
- PRKG2 (14)
- CAMK2A (11)
- CLCA1 (9)
- PRKACA (8)
- OR51E1 (7)
- GRK3 (6)
- CAMK2G (5)
- OR10J5 (5)
- OR2M2 (5)
- ARRB2 (4)
- CALM2 (4)
- OR10G9 (4)
- OR13C5 (4)
- PRKACB (4)
- CALM3 (3)
- CAMK2D (3)
- OR10A2 (3)
- OR10A6 (3)
- OR10G2 (3)
- OR10H4 (3)
- OR10J3 (3)
- OR10S1 (3)
- OR10X1 (3)
- OR1D2 (3)
- OR2AT4 (3)
- OR2F2 (3)
- OR2H2 (3)
- OR2J2 (3)
- OR2W3 (3)
- OR4A15 (3)
- OR4A47 (3)
- OR4K14 (3)
- OR4L1 (3)
- OR51S1 (3)
- OR52A1 (3)
- OR52A5 (3)
- OR52D1 (3)
- OR52E2 (3)
- OR5B12 (3)
- OR5I1 (3)
- OR5P3 (3)
- OR5V1 (3)
- OR6K2 (3)
- OR6Q1 (3)
- OR8B4 (3)
- OR8D1 (3)
- OR9G1 (3)
- OR9Q1 (3)
- PDE1C (3)
- PRKACG (3)
- PRKX (3)
- ADCY3 (2)
- CLCA4 (2)
- CNGA4 (2)
- OR10A4 (2)
- OR10AD1 (2)
- OR10AG1 (2)
- OR10C1 (2)
- OR10H1 (2)
- OR10H5 (2)
- OR10J1 (2)
- OR10P1 (2)
- OR10R2 (2)
- OR10V1 (2)
- OR10Z1 (2)
- OR12D3 (2)
- OR13C9 (2)
- OR13G1 (2)
- OR13J1 (2)
- OR14J1 (2)
- OR1D5 (2)
- OR1J4 (2)
- OR1N1 (2)
- OR1S1 (2)
- OR2A1 (2)
- OR2A25 (2)
- OR2A4 (2)
- OR2A7 (2)
- OR2AG1 (2)
- OR2AK2 (2)
- OR2B11 (2)
- OR2B2 (2)
- OR2C1 (2)
- OR2G6 (2)
- OR2J3 (2)
- OR2M3 (2)
- OR2M7 (2)
- OR2T1 (2)
- OR2T11 (2)
- OR2T12 (2)
- OR2T2 (2)
- OR2W1 (2)
- OR2Z1 (2)
- OR3A1 (2)
- OR3A2 (2)
- OR4A16 (2)
- OR4C12 (2)