Beta Arrestin 2 (ARRB2) Rabbit Polyclonal Antibody

CAT#: TA346492

Rabbit Polyclonal Anti-ARRB2 Antibody

Product Images

Sample Type: Lane 1: 20ug mouse left ventricle heart lysate Primary Antibody Dilution: 1: 1000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1: 5000

• 

  Sample Type: HepG2 cell lysate; Antibody concentration: 1.0 ug/ml; Gel concentration: 12%.ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human Skin

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: arrestin beta 2
• Database Link:
  NP_945355
  Entrez Gene 216869 MouseEntrez Gene 409 Human
  UniProt ID P32121
• Background: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012]
• Synonyms: ARB2; ARR2; BARR2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway, Endocytosis, MAPK signaling pathway, Olfactory transduction