Antibodies

Jump to Filters
View as table Download
OR5K2 Rabbit Polyclonal Antibody
TA337530

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR5K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5K2 antibody is: synthetic peptide directed towards the middle region of Human OR5K2. Synthetic peptide located within the following region: ILLTIFRMKSKEGRAKAFSTCASHFSSVSLFYGSIFFLYIRPNLLEEGGN