Antibodies

Jump to Filters
View as table Download
OR9Q1 Rabbit Polyclonal Antibody
TA316241

USD 345.00

In Stock

Rabbit polyclonal anti-OR9Q1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR9Q1.
OR9Q1 (C-term) Rabbit Polyclonal Antibody
AP53114PU-N

USD 450.00

2 Weeks

OR9Q1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 282-312 amino acids from the C-terminal region of human Olfactory receptor 9Q1
OR9Q1 Rabbit Polyclonal Antibody
TA332288

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR9Q1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR9Q1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR9Q1. Synthetic peptide located within the following region: SQAKTFSTCTSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEVI