Antibodies

Jump to Filters
View as table Download
SHMT1 (374-483) Mouse Monoclonal Antibody [Clone ID: 4F9]
AM20941PU-N

USD 480.00

2 Weeks

SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified

Applications ELISA, IHC, WB
Reactivities Human
SHMT1 Rabbit Polyclonal Antibody
TA330971

USD 375.00

5 Days

Rabbit polyclonal Anti-SHMT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHMT1 antibody: synthetic peptide directed towards the N terminal of human SHMT1. Synthetic peptide located within the following region: NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYG
SHMT1 Rabbit Polyclonal Antibody
TA356763

USD 360.00

5 Days

SHMT1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence LVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALT