Antibodies

View as table Download

Goat Anti-MTHFS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KRCLQHQEVKPYT, from the internal region of the protein sequence according to NP_006432.1.

Rabbit Polyclonal Anti-MTHFS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFS antibody: synthetic peptide directed towards the middle region of human MTHFS. Synthetic peptide located within the following region: TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY

Rabbit Polyclonal Anti-MTHFS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTHFS antibody: synthetic peptide directed towards the middle region of human MTHFS. Synthetic peptide located within the following region: TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY