Goat Anti-CPT1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KSSTKTDSHRLGQH, from the internal region of the protein sequence according to NP_689572.1; NP_001129524.1. |
Goat Anti-CPT1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KSSTKTDSHRLGQH, from the internal region of the protein sequence according to NP_689572.1; NP_001129524.1. |
Goat Polyclonal Antibody against FABP2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EGVEAKRIFKKD, from the C Terminus of the protein sequence according to NP_000125.1. |
Rabbit polyclonal anti-SCD (stearoyl-CoA desaturase) antibody
Applications | WB |
Reactivities | Hamster, Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 206 of rat SCD |
Goat Polyclonal Antibody against PCK2 / PEPCK-M
Applications | WB |
Reactivities | Human, Mouse, Rat, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KPWKPGDKEPCAH, from the internal region of the protein sequence according to NP_004554.2. |
Goat Polyclonal Antibody against PPAR delta (Isoform 1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CHPLLQEIYKDMY, from the C Terminus of the protein sequence according to NP_006229.1. |
Goat Polyclonal Antibody against RXR beta
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CRDGMGDSGRDSRSP, from the internal region of the protein sequence according to NP_068811. |
Goat Polyclonal Antibody against RXR gamma
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RQRSRERAESEAEC, from the internal region of the protein sequence according to NP_008848. |
Goat Polyclonal Antibody against SORBS1
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GTFPGNYVKPLYL, from the C Terminus of the protein sequence according to NP_006425.2; NP_056200.1; NP_001030126.1; NP_001030127.1; NP_001030128.1; NP_079267.1; NP_001030129.1. |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Rabbit polyclonal antibody to Retinoid X Receptor beta (retinoid X receptor, beta)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 20 and 113 of Retinoid X Receptor beta (Uniprot ID#P28702) |
Goat Anti-CPT2 (aa141-154) Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PKSEYNDQLTRATN, from the internal region of the protein sequence according to NP_000089.1. |
Goat Anti-FACL4 / ACSL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HYLKDIERMYGGK, from the C Terminus of the protein sequence according to NP_004449.1; NP_075266.1. |
Rabbit Polyclonal Anti-PCK1 Antibody
Applications | WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |