Antibodies

View as table Download

Anti-TRAF6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 350-522 amino acids of human TNF receptor-associated factor 6, E3 ubiquitin protein ligase

Rabbit anti-TRAF6 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TRAF6

Rabbit Polyclonal TRAF6 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRAF6 antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human TRAF6.

Rabbit Polyclonal TRAF-6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 451-469 (DAKPELLAFQRPTIPRNPK) of human TRAF6 was used as immunogen, GenBank no. NP_665802.1.

Rabbit Polyclonal anti-TRAF6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRAF6 antibody: synthetic peptide directed towards the middle region of human TRAF6. Synthetic peptide located within the following region: YVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV

Rabbit Polyclonal Anti-TRAF6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRAF6 antibody is: synthetic peptide directed towards the C-terminal region of Human TRAF6. Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA

Rabbit Polyclonal TRAF-6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Anti-TRAF6 polyclonal antibody was raised against a peptide corresponding to amino acids between 410 and 460 of human TRAF6.

Anti-TRAF6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 350-522 amino acids of human TNF receptor-associated factor 6, E3 ubiquitin protein ligase