Antibodies

Jump to Filters
View as table Download
PFKM Rabbit Polyclonal Antibody
TA308655

USD 415.00

5 Days

Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237)
PFKM Rabbit Polyclonal Antibody
TA332713

USD 275.00

3 Weeks

Rabbit anti-PFKM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PFKM
PFKM Mouse Monoclonal Antibody [Clone ID: AT2F11]
AM50026PU-N

USD 340.00

2 Weeks

PFKM mouse monoclonal antibody, clone AT2F11, Purified

Applications ELISA, FC, WB
Reactivities Human
PFKM Mouse Monoclonal Antibody [Clone ID: AT2F11]
AM50026PU-S

USD 230.00

2 Weeks

PFKM mouse monoclonal antibody, clone AT2F11, Purified

Applications ELISA, FC, WB
Reactivities Human
PFKM Rabbit Polyclonal Antibody
TA343124

USD 375.00

5 Days

Rabbit Polyclonal Anti-PFKM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA