Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TKT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TKT antibody: synthetic peptide directed towards the N terminal of human TKT. Synthetic peptide located within the following region: ESYHKPDQQKLQALKDTANRLRISSIQATTAAGSGHPTSCCSAAEIMAVL |
Rabbit Polyclonal Anti-TKT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TKT |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Anti-TKT (Transketolase) mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- TKT
Pathways
- Pentose phosphate pathway