Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 20 of 20 results

(reset)

ACADM Rabbit Polyclonal Antibody

TA332452

USD 275.00

3 Weeks

Rabbit anti-ACADM Polyclonal Antibody

Applications	ICC/IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human ACADM

ACADM Rabbit Polyclonal Antibody

AP17073PU-N

USD 450.00

2 Weeks

ACADM rabbit polyclonal antibody, Purified

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 196~225 amino acids from the Center region of Human ACADM.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ACADM Rabbit Polyclonal Antibody

TA331168

USD 310.00

5 Days

Rabbit Polyclonal Anti-ACADM Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

ACADM Goat Polyclonal Antibody

TA302400

USD 375.00

5 Days

Goat Polyclonal Antibody against ACADM

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-RLIVAREHIDKYKN, from the C Terminus of the protein sequence according to NP_000007.1.

1 / 2

2 / 2

Previous Next

ACADM Rabbit Polyclonal Antibody

TA331167

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACADM Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: AAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQAT

ACADM Mouse Monoclonal Antibody [Clone ID: OTI2G7]

CF811761

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI2G7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI10A5]

CF811764

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI10A5

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI9G10]

CF811769

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ACADM mouse monoclonal antibody,clone OTI9G10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI2G7]

TA811761

USD 379.00

In Stock

ACADM mouse monoclonal antibody,clone OTI2G7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G7]

TA811761AM

USD 420.00

4 Weeks

ACADM mouse monoclonal antibody,clone OTI2G7, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G7]

TA811761BM

USD 420.00

4 Weeks

ACADM mouse monoclonal antibody,clone OTI2G7, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI2G7]

TA811761S

USD 159.00

2 Days

ACADM mouse monoclonal antibody,clone OTI2G7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ACADM Mouse Monoclonal Antibody [Clone ID: OTI10A5]

TA811764

USD 379.00

In Stock

ACADM mouse monoclonal antibody,clone OTI10A5

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI10A5]

TA811764AM

USD 420.00

4 Weeks

ACADM mouse monoclonal antibody,clone OTI10A5, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10A5]

TA811764BM

USD 420.00

4 Weeks

ACADM mouse monoclonal antibody,clone OTI10A5, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI10A5]

TA811764S

USD 159.00

2 Days

ACADM mouse monoclonal antibody,clone OTI10A5

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ACADM Mouse Monoclonal Antibody [Clone ID: OTI9G10]

TA811769

USD 379.00

In Stock

ACADM mouse monoclonal antibody,clone OTI9G10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACADM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9G10]

TA811769AM

USD 420.00

4 Weeks

ACADM mouse monoclonal antibody,clone OTI9G10, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACADM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9G10]

TA811769BM

USD 420.00

4 Weeks

ACADM mouse monoclonal antibody,clone OTI9G10, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ACADM Mouse Monoclonal Antibody [Clone ID: OTI9G10]

TA811769S

USD 159.00

2 Days

ACADM mouse monoclonal antibody,clone OTI9G10

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 20 of 20 results