Antibodies

View as table Download

Rabbit polyclonal PRS4 Antibody (C-term)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This PRS4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 408-436 amino acids from the C-terminal region of human PRS4.

Rabbit polyclonal Anti-Psmc1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Psmc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG

Rabbit Polyclonal Anti-PSMC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMC1