S4 (PSMC1) Rabbit Polyclonal Antibody

CAT#: TA342172

Rabbit polyclonal Anti-Psmc1 Antibody

Product Images

WB Suggested Anti-Psmc1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Brain

• 

  Lanes: ; 1: 10ug proteasome fraction from C57B1/6J mouse brain, 2: 10ug proteasome fraction from BLAB/C mouse brain; Primary Antibody Dilution: ; 1:500; Secondary Antibody: ; Anti-rabbit HRP; Secondary Antibody Dilution: ; 1:5000; Gene Name: ; Psmc1; Subm

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Psmc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: proteasome 26S subunit, ATPase 1
• Database Link:
  NP_002793
  Entrez Gene 19179 Mouse
  UniProt ID P62191
• Background: The 26S protease is involved inThe ATP-dependent degradation of ubiquitinated proteins.The regulatory (or ATPase) complex confers ATP dependency and substrate specificity toThe 26S complex.
• Synonyms: P26S4; p56; S4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Proteasome