Antibodies

Jump to Filters
View as table Download
POLE4 Rabbit Polyclonal Antibody
TA345274

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLE4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLE4 antibody: synthetic peptide directed towards the N terminal of human POLE4. Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV
POLE4 Rabbit Polyclonal Antibody
TA315619

USD 345.00

In Stock

Rabbit polyclonal anti-POLE4 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLE4.