POLE4 Rabbit Polyclonal Antibody

CAT#: TA345274

Rabbit Polyclonal Anti-POLE4 Antibody

Product Images

WB Suggested Anti-POLE4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POLE4 antibody: synthetic peptide directed towards the N terminal of human POLE4. Synthetic peptide located within the following region: MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: polymerase (DNA) epsilon 4, accessory subunit
• Database Link:
  NP_063949
  Entrez Gene 56655 Human
  UniProt ID Q9NR33
• Background: POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
• Synonyms: p12; YHHQ1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Bovine: 86%; Rat: 79%

Reference Data

• Protein Pathways: Base excision repair, DNA replication, Metabolic pathways, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism