Rabbit polyclonal RPC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC3. |
Rabbit polyclonal RPC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC3. |
Rabbit Polyclonal Anti-POLR3C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR3C antibody: synthetic peptide directed towards the middle region of human POLR3C. Synthetic peptide located within the following region: VEAIIASMQATGAEEAQLQEIEEMITAPERQQLETLKRNVNKLDASEIQV |
Carrier-free (BSA/glycerol-free) POLR3C mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
POLR3C (RPC62) mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
POLR3C mouse monoclonal antibody,clone 2H1, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
POLR3C mouse monoclonal antibody,clone 2H1, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POLR3C (RPC62) mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |