Antibodies

View as table Download

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY

Carrier-free (BSA/glycerol-free) CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".