Antibodies

Jump to Filters
View as table Download
CANT1 (N-term) Rabbit Polyclonal Antibody
AP17919PU-N

USD 450.00

2 Weeks

CANT1 (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of Human CANT1/SHAPY.
CANT1 Rabbit Polyclonal Antibody
TA340307

USD 375.00

5 Days

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: VAVEWDKDHGVLESHLAEKGRGMELSDLIVFNGKLYSVDDRTGVVYQIEG
CANT1 Rabbit Polyclonal Antibody
TA340308

USD 375.00

5 Days

Rabbit Polyclonal Anti-CANT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CANT1 antibody: synthetic peptide directed towards the middle region of human CANT1. Synthetic peptide located within the following region: SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY
CANT1 Mouse Monoclonal Antibody [Clone ID: OTI7F8]
CF805629

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CANT1 Mouse Monoclonal Antibody [Clone ID: OTI7F8]
TA805629

USD 379.00

In Stock

CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CANT1 Mouse Monoclonal Antibody [Clone ID: OTI7F8]
TA805629S

USD 159.00

2 Days

CANT1 mouse monoclonal antibody, clone OTI7F8 (formerly 7F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".