Antibodies

Jump to Filters
View as table Download
ABI2 Rabbit Polyclonal Antibody
TA343153

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABI2 antibody is: synthetic peptide directed towards the N-terminal region of Human ABI2. Synthetic peptide located within the following region: MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTT