ABI2 Rabbit Polyclonal Antibody

CAT#: TA343153

Rabbit Polyclonal Anti-ABI2 Antibody

Product Images

WB Suggested Anti-ABI2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABI2 antibody is: synthetic peptide directed towards the N-terminal region of Human ABI2. Synthetic peptide located within the following region: MLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: abl-interactor 2
• Database Link:
  NP_005750
  Entrez Gene 10152 Human
  UniProt ID Q9NYB9
• Background: ABI2 may act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. ABI2 is a part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. It regulates ABL1/c-Abl-mediated phosphorylation of MENA.
• Synonyms: ABI-2; ABI2B; AblBP3; AIP-1; argBP1; argBPIA; argBPIB; SSH3BP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 85%; Yeast: 83%

Reference Data

• Protein Pathways: Regulation of actin cytoskeleton