Antibodies

Jump to Filters
View as table Download
ENAH Rabbit Polyclonal Antibody
TA344908

USD 475.00

5 Days

Rabbit Polyclonal Anti-ENAH Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Enah antibody is: synthetic peptide directed towards the C-terminal region of Mouse Enah. Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG
ENAH Rabbit Polyclonal Antibody
TA590490

USD 409.00

In Stock

Rabbit Polyclonal MENA Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.