Antibodies

Jump to Filters
View as table Download
UGT (UGT2B4) Rabbit Polyclonal Antibody
TA338455

USD 375.00

5 Days

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE
UGT (UGT2B4) Rabbit Polyclonal Antibody
TA350581

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-UGT2B4 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human UGT2B4